Protein Info for GFF4609 in Sphingobium sp. HT1-2

Annotation: COG1028: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 201 to 218 (18 residues), see Phobius details PF00106: adh_short" amino acids 5 to 183 (179 residues), 122.4 bits, see alignment E=3.5e-39 PF13561: adh_short_C2" amino acids 10 to 221 (212 residues), 119.2 bits, see alignment E=4.5e-38 PF08659: KR" amino acids 41 to 169 (129 residues), 23.8 bits, see alignment E=7.8e-09

Best Hits

KEGG orthology group: None (inferred from 58% identity to bcm:Bcenmc03_5484)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF4609 COG1028: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Sphingobium sp. HT1-2)
MMAGVVAVTGAAGALGRAAVQVLRAAGWTVAGIDLGDVPADGVDLALGGIDLSDEQAVAG
AAAKIGEALGGLDGLVNIAGGFSWETVEDGSVATWDRLYGMNVRTALIATRALLPLLRDG
GGAIVNIGAAASVKAAAGMGAYAASKAGVARLTEALAEELKDAGVRVNAVLPSIIDTPAN
RADMPDADASRWVSSEALGGVIAFLLSPAAAPITGALIPVTGRV