Protein Info for GFF4603 in Xanthobacter sp. DMC5

Annotation: Bicarbonate transport ATP-binding protein CmpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00005: ABC_tran" amino acids 34 to 180 (147 residues), 94.3 bits, see alignment E=5.2e-31

Best Hits

Swiss-Prot: 53% identical to Y4187_BRUSU: Putative ATP-binding protein BRA1187/BS1330_II1178 (BRA1187) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 72% identity to mlo:mlr7115)

Predicted SEED Role

"ABC transporter related( EC:3.6.3.25 )"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF4603 Bicarbonate transport ATP-binding protein CmpD (Xanthobacter sp. DMC5)
MTAPASAIAASPPKLEIRHLNKSFGTGAQQIEILRDINLDLAANEFVSVVGTSGCGKSTL
LSIVAGLETFDDPSGGRDYSPVRIDGAPVFDAGLDRGVVFQSYTLLPWLTAQQNVEFALQ
AAGMEAAERRRVAEEHIALVKLERFANAYPSELSGGMKQRVAIARALSYRPKMLLMDEPF
GALDALTRQQMQELLMQVWEQHRLTVLFVTHDVEEAVYLSDRIVVMGIGPGRVRETFRVD
LPRPRTSEIVETEEFLALQHKVLKAIREAAQRLPG