Protein Info for GFF4599 in Sphingobium sp. HT1-2

Annotation: L-carnitine dehydratase/bile acid-inducible protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 124 to 145 (22 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details PF02515: CoA_transf_3" amino acids 22 to 388 (367 residues), 434 bits, see alignment E=2.5e-134

Best Hits

KEGG orthology group: None (inferred from 50% identity to pgv:SL003B_3142)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF4599 L-carnitine dehydratase/bile acid-inducible protein F (Sphingobium sp. HT1-2)
MGRPTERCMMDSHDKSEWAGPLAGVRVLDFTRVLAGPSAALALADLGAEVIKVEPPGSGD
DTRSFPPLREGESHYFLSVNRGKKSIVLDLKAPEGLAIARDLAAKSDIVIENYRPGVMDR
LGLGYEALSALNPGLIYCAISGFGMTGPLKDRPSFDIVLQAMSGALSVNGEPGGLPTKLG
IPLGDLVGGINGPIAILAALHERHATGRGRLIDISLMDGMIGLLGYLAQLSFFTGQDPVP
QGSQHPNLVPYGVFPASDGSIVIACLTNHFWGKICAALGLDALADDPRYDRLDKRRERRA
EVNALLSAVTQTRTVADLADLFAAHQVPHAPILTISEALAQPQTLARNMVVETEHKSLGT
IPIVNRPFRFPGAEQPVPSAPPVLGEHSDMVLADLLGMDAQTIARLRDAGIVA