Protein Info for GFF4591 in Variovorax sp. SCN45

Annotation: Glutamate/aspartate ABC transporter, permease protein GltK (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 17 to 113 (97 residues), 78.4 bits, see alignment E=2.4e-26 PF00528: BPD_transp_1" amino acids 36 to 218 (183 residues), 68 bits, see alignment E=4.6e-23

Best Hits

Swiss-Prot: 48% identical to GLTK_ECOL6: Glutamate/aspartate import permease protein GltK (gltK) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 86% identity to aaa:Acav_3986)

MetaCyc: 48% identical to glutamate/aspartate ABC transporter membrane subunit GltK (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>GFF4591 Glutamate/aspartate ABC transporter, permease protein GltK (TC 3.A.1.3.4) (Variovorax sp. SCN45)
MMNLDFSFYNWSLVSTYVLKGFYFSVILTVVATLGGIFFGTLLALMRLSGKKWLDFPAAA
YVNGMRSVPLVMVILGFFLLVPFVIGHPIGAETSAVITFICFEAAYFSEIMRAGIQSIPR
GQVFAGQAVGMTYSQNMKLVILPQAFRNMLPVLLTQTIILFQDTSLVYAIGAYDMLKGFE
TAGKNFGRPEEAYLLAAVVYFVLCYALSWLVKRLHKKIAIIR