Protein Info for GFF4590 in Variovorax sp. SCN45

Annotation: Glutamate/aspartate ABC transporter, ATP-binding protein GltL (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 169 (149 residues), 124.2 bits, E=6e-40

Best Hits

Swiss-Prot: 74% identical to GLTL_ECOLI: Glutamate/aspartate import ATP-binding protein GltL (gltL) from Escherichia coli (strain K12)

KEGG orthology group: K10004, glutamate/aspartate transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 98% identity to vpe:Varpa_0855)

MetaCyc: 74% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport ATP-binding protein GltL (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Protein Sequence (249 amino acids)

>GFF4590 Glutamate/aspartate ABC transporter, ATP-binding protein GltL (TC 3.A.1.3.4) (Variovorax sp. SCN45)
MSEKMIEIKNVSKWYGPVQVLNDCSVNISKGDVVVVCGPSGSGKSTLIKTVNALEPFQKG
EITVNGIPLHDPKTNLPKLRSKVGMVFQHFELFPHLSVTENLTIAQIKVLGRSADEAKTR
GLKMLDRVGLMAHKDKFPGQLSGGQQQRVAIARALSMDPIVMLFDEPTSALDPEMVGEVL
DVMVSLAKEGMTMMVVTHEMAFARKVASRVIFIDVGGRILEDCPKDEFFGHPENRQPRTK
DFLNKILQH