Protein Info for PS417_02345 in Pseudomonas simiae WCS417

Annotation: 3-deoxy-D-manno-octulosonic acid transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 51 to 68 (18 residues), see Phobius details amino acids 316 to 333 (18 residues), see Phobius details amino acids 345 to 361 (17 residues), see Phobius details PF04413: Glycos_transf_N" amino acids 34 to 212 (179 residues), 230.1 bits, see alignment E=1.4e-72 PF00534: Glycos_transf_1" amino acids 302 to 402 (101 residues), 28.3 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 56% identical to KDTA_ECOL6: 3-deoxy-D-manno-octulosonic acid transferase (waaA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02527, 3-deoxy-D-manno-octulosonic-acid transferase [EC: 2.-.-.-] (inferred from 95% identity to pfs:PFLU0490)

MetaCyc: 56% identical to KDO transferase (Escherichia coli K-12 substr. MG1655)
KDOTRANS2-RXN [EC: 2.4.99.13]; KDOTRANS-RXN [EC: 2.4.99.13, 2.4.99.12]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.12 or 2.4.99.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYZ2 at UniProt or InterPro

Protein Sequence (425 amino acids)

>PS417_02345 3-deoxy-D-manno-octulosonic acid transferase (Pseudomonas simiae WCS417)
MNRTLYSCLFYLALPLVALRLWLRARKAPAYAKRVGERFSYGLPVMQPGGIWVHAVSVGE
SIAAAPMVRGLLARYPTLPITVTCMTPTGSERIQALFANEPRIQHCYLPYDLPCAAKRFL
DRVQPKLAVIMETELWPNHIHACAQRGIPVALANARLSARSAKGYARFAKLTAPMLSQMS
LFAVQTQTEAQRFLSLGARPETVEVTGSIKFDLTIDPELPARAAALRAQWGASERPVWIA
ASTHEGEDDVVLAAHRQLLDSYPNALLILVPRHQERFGPMFERCQQQGFATVRRSSGDAV
TAQTAVLLGDTMGELLFLYALADSAFVGGSLVATGGHNPLEPAALALPVIMGPHVFNFLE
ITAMMREAGALREVDDAEGLAEAVRQLFELPQDARKMAQAGLKVMQANQGALKRLLDGLD
KLLTR