Protein Info for GFF4589 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 247 to 247 (1 residues), see Phobius details amino acids 260 to 290 (31 residues), see Phobius details amino acids 297 to 324 (28 residues), see Phobius details amino acids 336 to 362 (27 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 39 to 310 (272 residues), 105.3 bits, see alignment E=1.6e-34

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 78% identity to rfr:Rfer_2389)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>GFF4589 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTSKHYEFKPLNVGRWLTWGLFALLLIVAPRIFTSGLAMTVLSQMGIAIIACLSYNILLG
QGGMLSFGHAVYTGLGSFLAIHALNSVTAGSLPLPVSLVPIVGGLAGVGFAVLFGYVTTR
KSGTTFAMITLGLGELVFALSLMIPEFFGGEGGVSGDRMAGKPFMGITYGPQVQVYYLIA
VYTFISVGLMFAFTRTPLGRMLNAVRDNPERVEFVGYDTQRVRYIAFIIAGFFAGISGGL
GALNFEIVTAEVVGAARSGAYLLFTFLGGATFFFGPIIGGILMVLAFVLLSEFTKAWLLY
LGLIFLFMVIYAPGGIASLIMMNLRVAAFGRLRELWVSYLALAGTALVMLAGAAAMIEMI
YHLQLNTTLGSELRFLGVPLDAHSVNSWFGSAMVMLTGLGLFELTRRTFLREWGEIQEYI
EKEIKRREAL