Protein Info for GFF4584 in Xanthobacter sp. DMC5

Annotation: Nif-specific regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 TIGR01817: Nif-specific regulatory protein" amino acids 26 to 592 (567 residues), 758.8 bits, see alignment E=1.7e-232 PF13185: GAF_2" amino acids 44 to 186 (143 residues), 44.7 bits, see alignment E=6.5e-15 PF01590: GAF" amino acids 44 to 185 (142 residues), 62.2 bits, see alignment E=3.1e-20 PF00158: Sigma54_activat" amino acids 230 to 396 (167 residues), 240.4 bits, see alignment E=3.4e-75 PF14532: Sigma54_activ_2" amino acids 231 to 401 (171 residues), 76.8 bits, see alignment E=8.3e-25 PF07728: AAA_5" amino acids 253 to 378 (126 residues), 34.3 bits, see alignment E=9.4e-12 PF00004: AAA" amino acids 254 to 375 (122 residues), 26.5 bits, see alignment E=3.1e-09 PF02954: HTH_8" amino acids 546 to 585 (40 residues), 48.1 bits, see alignment 3e-16

Best Hits

KEGG orthology group: K02584, Nif-specific regulatory protein (inferred from 90% identity to xau:Xaut_0082)

Predicted SEED Role

"Nitrogenase (molybdenum-iron)-specific transcriptional regulator NifA" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (592 amino acids)

>GFF4584 Nif-specific regulatory protein (Xanthobacter sp. DMC5)
MVQQEALQIEREQPRSHVPLVSLSDVALTGIYEISKILTAPNRLETTLSSVVNLLSSFMQ
MRHGVISLLEDDGIPDITVGGGWNEGTDARYRARLPEKAIGQVIATAVPLIAENVASHPA
FSEADAQALGASEDSRVSFIGVPIRVASRVIGTLTIDRVWDGRSVFRLDSDVRFLTMVAN
LIGQTVQLHRVVSRDRERLMAESGRLQKELSELKPTSAGRERKRVYVDGIIGDSREIRGL
LDKIMIVAKSHSPVLLRGESGTGKELIAKAIHELSPRAKGPFIKLNCAALPESVLESELF
GHEKGAFTGAVGARKGRFELADKGTLFLDEIGEISPSFQAKLLRVLQEQEFERVGGSHTL
KVNVRVVAATNKNLEEAVAKNEFRADLYYRISVIPVIVPSLRDRRGDIPLLANEFLDRFN
RENGRDLHFNQDAMDVLMGCGFPGNVRELENCVQRTATLAQGGSIVGDDFACRHNECLSA
LLWRSPADAPQTRRPMEIPLPVMPPLSAISGEAANSNTVPRLPPLTVPVPTPAPAVPVRA
TVLDEEMSERERLVDAMERAGWVQAKAARLLGLTPRQIGYALKKHDIEIKRF