Protein Info for GFF4581 in Xanthobacter sp. DMC5

Annotation: Deoxyuridine 5'-triphosphate nucleotidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 TIGR00576: dUTP diphosphatase" amino acids 8 to 150 (143 residues), 171.8 bits, see alignment E=3.4e-55 PF00692: dUTPase" amino acids 18 to 150 (133 residues), 101.7 bits, see alignment E=2.6e-33 PF22769: DCD" amino acids 39 to 123 (85 residues), 43.3 bits, see alignment E=4.3e-15

Best Hits

Swiss-Prot: 68% identical to DUT_PARL1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 73% identity to xau:Xaut_0077)

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>GFF4581 Deoxyuridine 5'-triphosphate nucleotidohydrolase (Xanthobacter sp. DMC5)
VTKPPVKIQRLPHAAGLPLPAYATPGAAGMDLACALPADAPLLLAPGARAAIPTGFAIAL
PDGYEAQVRPRSGLAKNHGVTVLNAPGTVDCDYRGEIAVLLVNHGRETLEISRGMRIAQL
VVAPVVQIMLEEIGELSETARGSGGFGSTGLGST