Protein Info for GFF4579 in Variovorax sp. SCN45

Annotation: putative oxidoreductase, nitronate monooxygenase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03060: NMO
  • amino acids 3 to 309 (307 residues), 210.6 bits, E=4.3e-66
• PF00478: IMPDH
  • amino acids 164 to 212 (49 residues), 26.1 bits, 4.4e-10

Best Hits

Swiss-Prot: 63% identical to NQRED_PSEAE: NADH:quinone reductase (PA1024) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00459, nitronate monooxygenase [EC: 1.13.12.16] (inferred from 96% identity to vpe:Varpa_0869)

MetaCyc: 38% identical to enoyl-[acyl-carrier-protein] reductase II (NADPH) monomer (Porphyromonas gingivalis W83)
Enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific). [EC: 1.3.1.10, 1.3.1.104, 1.3.1.39]

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.9)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• biotin biosynthesis I (14/15 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (25/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (25/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (25/34 steps found)
• alkylnitronates degradation (2/2 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.13.12.16, 1.3.1.9

Use Curated BLAST to search for 1.13.12.16 or 1.3.1.10 or 1.3.1.104 or 1.3.1.39 or 1.3.1.9

Protein Sequence (323 amino acids)

>GFF4579 putative oxidoreductase, nitronate monooxygenase family (Variovorax sp. SCN45)
MKTRITELLGIRYPIIQGGMQWVGRAELAAAVSNAGGLGIVTALTQPTPDDLRNEIARTR
TLTDKPFGVNLTILPAVKPPPYAEYVQAIIDSGVKIVETAGNSPKDFIEALKRHDVKIVH
KCTSVRHALSAERNGVDAVSVDGFECAGHPGEDDVPGLVLLPIAARKLRIPIIASGGIAD
GRGMAAALALGAEGINMGTRFCVTKEAPIHDNIKQALVDATERDTKLMFRTMRNTARVFR
NAISEEVVATENRPGGCEFEEVRPLVAGARGRAALESGEVQNGVVSAGQCIGLIDDIPTC
AELLERMVRECREHLDRARAWMD