Protein Info for PS417_23400 in Pseudomonas simiae WCS417

Annotation: dihydropteridine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00042: Globin" amino acids 27 to 133 (107 residues), 53.6 bits, see alignment E=4.8e-18 PF00970: FAD_binding_6" amino acids 159 to 253 (95 residues), 45.4 bits, see alignment E=1.3e-15 PF00175: NAD_binding_1" amino acids 264 to 368 (105 residues), 44.9 bits, see alignment E=2.5e-15

Best Hits

Swiss-Prot: 78% identical to HMP_PSEPK: Flavohemoprotein (hmp) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K05916, nitric oxide dioxygenase [EC: 1.14.12.17] (inferred from 95% identity to pfs:PFLU5142)

Predicted SEED Role

"Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)" in subsystem Bacterial hemoglobins or Flavohaemoglobin or Glutaredoxins (EC 1.14.12.17)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8P5 at UniProt or InterPro

Protein Sequence (393 amino acids)

>PS417_23400 dihydropteridine reductase (Pseudomonas simiae WCS417)
MLSAQDRAIVKSTVPLLESGGEALITHFYRMMLSEYPQVRPLFNQAHQASGDQPRALANG
VLMYARHIDQLDQLGDLVAKIINKHVALQILPEHYPIVGACLLRAISEVLGSEIATPEVM
SAWGAAYGQLADILIGAEAAIYEEKAQAPGGWRGARPFLLVKRVEESDEIISFYFAPADN
GPILAAAPGQYIGMKLLLDGEEVRRNYSLSALTDAGVYRISVKREAGGRVSNYLHDQMQV
GATIDLFPPSGEFTLAASDKPLVLISGGVGITPTLPMLEAALATERPVHFIHCARNGGVH
AFRDWVDALAAKHPQLKRYYCYAEDNGVSPAADKVGLLSQDQLAAWLPEQRDIDAYFLGP
KGFMAAIKRHLQALGVPEKQSRYEFFGPAAALE