Protein Info for PS417_23395 in Pseudomonas simiae WCS417

Annotation: disulfide bond formation protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details PF02600: DsbB" amino acids 11 to 156 (146 residues), 128.1 bits, see alignment E=1.8e-41

Best Hits

Swiss-Prot: 83% identical to DSBB1_PSEF5: Disulfide bond formation protein B 1 (dsbB1) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 98% identity to pfs:PFLU5141)

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1ULY5 at UniProt or InterPro

Protein Sequence (168 amino acids)

>PS417_23395 disulfide bond formation protein B (Pseudomonas simiae WCS417)
MSDELRLGRERRFLVLLGIICLALIGGALYMQVVLGEAPCPLCILQRYALLLIAIFAFIG
AAMRTKGALTFFEGLVILSALGGVAAAGHHVYTQFFPQVSCGIDVLQPIVDDLPLAKVFP
LGFQVDGFCSTPYPPVLGLSLAQWALVAFVLTVILVPLGIYRNRQRKA