Protein Info for GFF4571 in Sphingobium sp. HT1-2

Annotation: Helicase PriA essential for oriC/DnaA-independent DNA replication

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF17764: PriA_3primeBD" amino acids 6 to 101 (96 residues), 68 bits, see alignment E=1.6e-22 PF04851: ResIII" amino acids 190 to 352 (163 residues), 49.3 bits, see alignment E=1.7e-16 PF00270: DEAD" amino acids 213 to 356 (144 residues), 68.5 bits, see alignment E=1.8e-22 TIGR00595: primosomal protein N'" amino acids 214 to 719 (506 residues), 608.8 bits, see alignment E=3.7e-187 PF18319: Zn_ribbon_PriA" amino acids 440 to 466 (27 residues), 34 bits, see alignment (E = 7e-12) PF18074: PriA_C" amino acids 628 to 718 (91 residues), 65.1 bits, see alignment E=2.5e-21

Best Hits

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 86% identity to sjp:SJA_C1-26780)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (722 amino acids)

>GFF4571 Helicase PriA essential for oriC/DnaA-independent DNA replication (Sphingobium sp. HT1-2)
MARARVLLLNAALGPLDYRIPHGMTARPGSIVVAPLGPRQLVGVVWDEESFPDVETVGDN
RLRNLLEVLDAPPLPETLRRLIEWTADYYLAPPAAVLRMALASMSALEGTRTVIEYRATG
QLPDRMTEQRTQAMERIGDRQGLVRELAMIGGVSDTVIRGLVKAGAFEPVEVSVYTPFPE
PDPAHAPPALSEQQMAAATDMADAVRAHEFAPFLLDGVTGSGKTEVYFEAIAAAIRAGKQ
TLVLLPEIALTEPFLERFEKRFGTVPVNWHSGLRQSERRRAWRAIAAGEARVVVGARSAL
FLPYPNLGLIVVDEAHEASFKQEEGVHYHARDVAVMRGLIEHFPVVLASATPAIETRHQV
DLGRYREIKLPARFGGAQMPDIEGINLLTDPPERGRWIAPPLVVAMEEVLAKGEQSLLFL
NRRGYAPLTLCRHCGYRFQCPNCTSWMVEHRLTKRLACHHCGHVIPAPRFCPECKEEDSL
VACGPGVERIADEVKALWPQARVAIATSDTLHSPARAADFVKSVEAGDIDIIVGTQLITK
GYHFPNLTLVGVIDADLGLEGGDLRASERTFQQIMQVAGRAGRGEKPGHVFIQTRMPDAE
VIQALIAGDSERFYLIETENRRRANAPPFGRFAAIIISSEDSDEAAQTARLIGKSAPQVE
GMRVYGPAPAPLSVLRGRHRHRLLIHATRQVDIQSVIREWLGNLVWKSTTRVAVDVDPYS
FM