Protein Info for PS417_23390 in Pseudomonas simiae WCS417

Annotation: ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 43 to 67 (25 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 16 to 238 (223 residues), 375 bits, see alignment E=5.7e-117 PF06481: COX_ARM" amino acids 238 to 281 (44 residues), 61.8 bits, see alignment 2.2e-21

Best Hits

Swiss-Prot: 72% identical to CYOA_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Pseudomonas putida

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 99% identity to pfs:PFLU5140)

MetaCyc: 73% identical to cytochrome bo terminal oxidase subunit II (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1A4 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PS417_23390 ubiquinol oxidase subunit II (Pseudomonas simiae WCS417)
MSKNRYPRLLGFLPLLGMMLMLGGCKWTLMDPKGQIGLDQRNLIITATLLMLLVVVPVII
MTFAFAWKYRASNTNATYAPKWSHSTKIEIAVWLVPILIIIALGYITYKSTHELDPYRPL
ESDVKPINIEVVALDWKWLFIYPDLGIATVNEIQFPENTPLNFRITSDAVMNSFFIPALG
GQIYAMAGMQTRLHLIANEKAEMEGISANYSGAGFTGMKFKAISTSQEGFNAWVAEVKAA
PKQLDQAEYDALTKPSQNNPVALYSAYEPNLFQKIVDKYEGMKPGKPVKHEKKEVAAVEG
SDTGSHSTAGAEE