Protein Info for PS417_23355 in Pseudomonas simiae WCS417

Annotation: 4-aminobutyrate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00202: Aminotran_3
  • amino acids 16 to 412 (397 residues), 351.8 bits, E=2.1e-109

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU5130)

MetaCyc: 78% identical to 4-aminobutyrate aminotransferase (Pseudomonas putida KT2440)
2-aminoadipate transaminase. [EC: 2.6.1.39]

Predicted SEED Role

"Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)" (EC 2.6.1.19)

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (10/13 steps found)
• 4-aminobutanoate degradation I (2/2 steps found)
• 4-aminobutanoate degradation III (2/2 steps found)
• GABA shunt II (3/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (8/11 steps found)
• superpathway of 4-aminobutanoate degradation (2/3 steps found)
• 4-aminobutanoate degradation II (1/2 steps found)
• GABA shunt I (2/4 steps found)
• L-lysine degradation V (5/9 steps found)
• L-lysine degradation II (L-pipecolate pathway) (4/9 steps found)
• L-lysine degradation XI (1/5 steps found)
• 4-aminobutanoate degradation V (2/7 steps found)
• L-lysine biosynthesis IV (2/9 steps found)
• L-lysine biosynthesis V (2/10 steps found)
• nicotine degradation I (pyridine pathway) (4/17 steps found)
• superpathway of L-lysine degradation (17/43 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Butanoate metabolism
• Glutamate metabolism
• Lysine biosynthesis
• Lysine degradation
• Propanoate metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.19

Use Curated BLAST to search for 2.6.1.19 or 2.6.1.39

Sequence Analysis Tools

See A0A1N7UN99 at UniProt or InterPro

Protein Sequence (416 amino acids)

>PS417_23355 4-aminobutyrate aminotransferase (Pseudomonas simiae WCS417)
MSHETISQSISIVHPISLSHGKNAEVWDTSGKRYIDFVGGIGVLNLGHCHPGVVDAIRDQ
ATRLTHYAFNAAPHAPYVELMDRLTAFIPVDYPISGMLTNSGAEAAENALKIVRGATGRT
AVIAFDGAFHGRTLATLNLNGKVAPYKQKVGVLPGPVYHLPYPSADNGVTCAEALKAMDR
LFSVEIDVSDVACFIIEPVQGEGGFLALDIEFAQALRRFCNENNILLIADEIQSGFGRTG
ERFAFSRLGIEPDLILLGKSIAGGVPLGAVVGRKALMDNLPKGGLGGTYSGNPIACAAAL
ATLDAMTDEHLSAWGSQQEEAIVSRYQTWRAHGLTPYLGRLTGVGSMRGIELANADGTPA
PKQLTQLLGLARDAGLLLMPSGKSRHIIRLLAPLTIEPAVLEEGLTMFEACLKQLD