Protein Info for GFF4562 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: TETRATRICOPEPTIDE REPEAT FAMILY PROTEIN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF08238: Sel1" amino acids 27 to 63 (37 residues), 22.3 bits, see alignment 7.6e-09 amino acids 65 to 99 (35 residues), 19 bits, see alignment 8.8e-08 amino acids 110 to 135 (26 residues), 19.1 bits, see alignment (E = 8.1e-08) amino acids 138 to 171 (34 residues), 47 bits, see alignment 1.3e-16 amino acids 174 to 205 (32 residues), 30.1 bits, see alignment 2.6e-11 amino acids 208 to 243 (36 residues), 51 bits, see alignment 6.9e-18 amino acids 245 to 279 (35 residues), 31.7 bits, see alignment 8.2e-12 amino acids 284 to 310 (27 residues), 28 bits, see alignment (E = 1.2e-10)

Best Hits

Swiss-Prot: 50% identical to YBEQ_ECOLI: Sel1-repeat-containing protein YbeQ (ybeQ) from Escherichia coli (strain K12)

KEGG orthology group: K07126, (no description) (inferred from 99% identity to sei:SPC_0671)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF4562 TETRATRICOPEPTIDE REPEAT FAMILY PROTEIN (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNHSITSHPCDNVSLAQLTELAQSGNSEAQYILGRLYNDERIDGSEEDKLSFYWLQQAAE
QGHCEAQYWLGLRYKDTPTDMKDNTLALFWSEKAAQQGHRHAFNTLGWVQEGETGMAPDY
AQAVAWYRKGAEQSHNLAQYNLGRMYHSGTGVEQNDTQALYWFKQAALQGHCASQERLAY
MYGNGKGCRKNLSLAALWYKKSALQESSYSQYQMGYCYYIGKGIKQDYQQAIYWFRKAAD
QGDDDAYNSIGWMYKCGHGVEQNYSLALEWFHKSAECNNSSGWYNLGCMYRDGHGTAQDL
QQALYWFKKAQPTGKWNVDEEIRKLEAQLHA