Protein Info for GFF4561 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Secretion protein HlyD precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 54 to 371 (318 residues), 214.6 bits, see alignment E=8.6e-68 PF16576: HlyD_D23" amino acids 72 to 291 (220 residues), 63.8 bits, see alignment E=1.4e-21 PF13437: HlyD_3" amino acids 191 to 286 (96 residues), 59.8 bits, see alignment E=4e-20

Best Hits

KEGG orthology group: None (inferred from 55% identity to vpe:Varpa_3450)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>GFF4561 Secretion protein HlyD precursor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNAAPPQSRKRWLWLAIALALVLLGVFWVFIKKPGNPEATAPAAEAKPRPSLTVTVAQPV
HGNLPIRLQANGNITAWQEASVGAEVNGLRLASVNVNVGDLVRKGQVLAVFASETTKADS
LQSQASLAQAEASFENAKADADRARSIQDTGALSKSQVAQYLTQERVARAQLEAAKAAFG
ATEVRLGNTRVLAPDDGVISARTATVGAVVGAGQELFRMVRQSRMEWRGEVTPNEVGRVR
VGQKVQVTAATGLEITGQVRAIAPGADPQTRNILVFVDLPRHAELKAGTFAKGSFDLGQS
DALTVPSQAIVVRDGSNYVFVIDAQSKANQRKVQTGRRVDDRVEVLEGLKPDEAVAVQGA
GFLNEADLVKVVQ