Protein Info for PS417_23340 in Pseudomonas simiae WCS417

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR00229: PAS domain S-box protein" amino acids 20 to 145 (126 residues), 49.6 bits, see alignment E=4.2e-17 PF00989: PAS" amino acids 21 to 135 (115 residues), 29.3 bits, see alignment E=1.9e-10 PF13188: PAS_8" amino acids 21 to 76 (56 residues), 25 bits, see alignment E=3.5e-09 PF13426: PAS_9" amino acids 37 to 135 (99 residues), 30 bits, see alignment E=1.3e-10 PF08447: PAS_3" amino acids 43 to 131 (89 residues), 88.1 bits, see alignment E=9.7e-29 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 180 to 335 (156 residues), 144 bits, see alignment E=3.7e-46 PF00990: GGDEF" amino acids 182 to 333 (152 residues), 143.7 bits, see alignment E=1.2e-45

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfs:PFLU5127)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U196 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PS417_23340 diguanylate cyclase (Pseudomonas simiae WCS417)
MTDISGNNPLEQDFSHFNADMLHTVLELVSDGIWDWNANTGFVYRNPGWYEMLGYHRHAL
ENNVFTWENVIHPDDYSQVMKLFDDYIHRRAPHYQAEYRCRKKDGSYLWIEDRGYVIARN
ADGSVARMVGAHRDIDLRKSSVEQLERRNQSLEALVAERTRELSRVNQQLQLQLDENRFL
AERDALTLVANRYRLEKVLLQECDRAQRFRLPLALIAMDIDDFKSINDRCGHGVGDQTLV
QVAECLQRCIRPEDLLARWGGDEFVLILPKTSLEIAKTMAANIRLKLKNSPHRDDFKVTL
SLGVAERQTDEPPAALMVRADQALYRAKAAGKDGVSE