Protein Info for GFF4560 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Propionate catabolism operon regulatory protein PrpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF06506: PrpR_N" amino acids 32 to 197 (166 residues), 140.9 bits, see alignment E=1.1e-44 PF00158: Sigma54_activat" amino acids 332 to 498 (167 residues), 223.4 bits, see alignment E=5.3e-70 PF14532: Sigma54_activ_2" amino acids 345 to 499 (155 residues), 46 bits, see alignment E=2.4e-15 PF00004: AAA" amino acids 355 to 474 (120 residues), 25.4 bits, see alignment E=6e-09 PF07728: AAA_5" amino acids 355 to 474 (120 residues), 27.1 bits, see alignment E=1.4e-09 PF01078: Mg_chelatase" amino acids 407 to 475 (69 residues), 22.2 bits, see alignment E=2.9e-08 PF25601: AAA_lid_14" amino acids 504 to 567 (64 residues), 49.1 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to spt:SPA2082)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (642 amino acids)

>GFF4560 Propionate catabolism operon regulatory protein PrpR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNKTKDIAASPLCFVSPYPQLAKAAEALVAQLDYAVTIHQTTLNRILDELPLLESRGHQV
LISRGGCAEILKKHSKLPVVEIKMSGYDILDALIPFKGQKGTVGIVGFSSVIKGCARVAE
QLNINYKIFTLQGNDKETISCLKRQLASTPLDCIVGDTVCQDYFSPLGSQFRLLDSSPAS
ITEALEEARSLYLAFRSQLLERHHLQLILDQFDKAVITLDDTGALLHYNKYASQLFKINA
SGEIYDASFLKQVLHQERHTLREGKTVSAKVVDTPQGAMVVNLYPVFAARQLSRVVLTMQ
TVSSLQGAEHHVRRQELSRRGLSARYHFDDLLTENPEMLRRLAIIKNYAGTDATILINGE
SGTGKEVLAQSIHNASQRVNGPFVAINCGAMAPQILESELFGYVAGAFTGASPKGKIGLF
ELAHHGTIFLDEISELDKPLQTRLLRVLQERQIMRLGSDQMIPVDIRVIAATNQTLTKLI
ADGTFREDLYYRLNVLKVTTIPLRKRPEDIKAIGLSLLTSFSQHYKRPALTLTPALWQEL
QRFAWPGNVRQLSNIIERLVLSIDHSPATLDEGRLLLDDLEEGSRREPTTCHDCQMLAGD
YKTIRLRILRKLLEAERDNKSLVAKRLNVDRTSLTRWIRESA