Protein Info for GFF4557 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details PF00892: EamA" amino acids 27 to 160 (134 residues), 55.9 bits, see alignment E=2.9e-19 amino acids 173 to 307 (135 residues), 58.2 bits, see alignment E=5.8e-20

Best Hits

KEGG orthology group: None (inferred from 41% identity to vei:Veis_0849)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF4557 hypothetical protein (Xanthobacter sp. DMC5)
MSTHTAPSQTTGPQAAGAPISTARYVAGALFGLASVTIWAGWMSITRLGVTSSLGVFDVT
MLRYATAGLVLLPVLLRHGLGLDRAKPWQLLVMIIGAGAPYAVVAGFGLRTTPAGQAGVL
IPGVMPLFVALISAVALRERFSMQRRVGYALILASVALIAGVGAVASGLGSGIGHLLCMA
GAFMWASYAVALRKSGLGALHAVAVVSVGSAVLYLPLYAMVHGFTVLDAPLRDVIFQAVY
QGVFATVISLFLFARSVALLGASAGAAFGACVPVLAALMAIPILGEYPSGTDWLGIFAAT
IGVYLASGGPLPRRA