Protein Info for PS417_23325 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 PF08446: PAS_2" amino acids 13 to 116 (104 residues), 89.3 bits, see alignment E=7e-29 PF01590: GAF" amino acids 146 to 308 (163 residues), 46.8 bits, see alignment E=1.1e-15 PF00360: PHY" amino acids 336 to 500 (165 residues), 140.4 bits, see alignment E=1.1e-44 PF00512: HisKA" amino acids 517 to 588 (72 residues), 52.6 bits, see alignment E=9.9e-18 PF02518: HATPase_c" amino acids 634 to 740 (107 residues), 100.6 bits, see alignment E=1.8e-32

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU5120)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6C0 at UniProt or InterPro

Protein Sequence (747 amino acids)

>PS417_23325 histidine kinase (Pseudomonas simiae WCS417)
MKPEDFEELLANCADEPIRFPGAIQPHGVLLTLSEPDLNIIQVSANVGSLFGHAPEALLG
QPLHTLVGAEHAKAVAVMADHNTFFDAPPLHVTFNGAEFEGLLHRHQNVLVLEFEPLLKD
FRPRALKGRTSDLGKMLQRLQSAKTLQALYEISVNEIQAMTGYDRVLIYRFEDEGHGQVI
AEASAPSMELFNGLFFPASDIPEQARELYRTNWLRIIPNAAYEPVPLLPKLRPDTGQPLD
LSFATLRSVSPIHCQYMQNMGVLSSMSISLMKGDTLWGLISCGNREPLLVPNDLRTACQT
IGQVLSLQISAMEALDLSRQREEKVEALALLDQAMKRSEENVFDGLAQQGQLLMDLTLSG
GVAIIEDKQLHRYGNCPEPAQIRALHKWLQEGGEPVFSSHKLSSVYPPAAEFQQVASGVL
AMSLPKPVDNGVLWFRPEVKENINWSGDPRKPLDLENSDSGLRLRPRTSFEIWKVEMAGI
STKWSHGDRFAANDLRRSALENDLARQVLREQQAVRARDELVAVVSHDLRNPMTVISMLC
GMMQQAFSSDGPHTSRRISSAIDTMQQAAGRMNVLLEDLLDTSKIEAGRYVVRPVSLDVS
QMFDEAYSLLAPLAMEKGIDLSFNAEPGLQINADPERLFQVLSNLIGNAIKFTPRQGNIG
ISAMSSGEEIVFSVRDSGEGIAPEQLPHVFDRYWTQTENNPTGSGLGLYITQGIVQAHGG
KIVAESEVGRGSEFRFTVPKVIDDSHT