Protein Info for GFF4554 in Variovorax sp. SCN45

Annotation: Protease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 5 to 27 (23 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details PF01435: Peptidase_M48" amino acids 81 to 288 (208 residues), 138.1 bits, see alignment E=1.6e-44

Best Hits

Swiss-Prot: 96% identical to HTPX_VARPS: Protease HtpX homolog (htpX) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 96% identity to vap:Vapar_0859)

Predicted SEED Role

"Heat shock protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF4554 Protease HtpX (Variovorax sp. SCN45)
LKRILLFVLTNVMVVAVLGVVASLLGVNRFLTANGLNLTALLGFALVMGFGGAIISLLIS
KPMAKWTSGLHMIDNPQTPDEAWIVGTVRKFADKAGIGMPEVGIFEGEPNAFATGAFKNS
SLVAVSTGLLQNMTREEVEAVIGHEVAHIANGDMVTMTLIQGVMNTFVVFLSRVIGYAVD
SFLRRGDDRSSGPGIGYYVSTIVLDIVLGFAAAMVVAWFSRHREFRADAGAAALMGQKQP
MINALARLGGLPAGELPKAVEAMGITGSMGKLFATHPPIEERIAALQNAQR