Protein Info for GFF4551 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF22029: PhyR_sigma2" amino acids 11 to 64 (54 residues), 46 bits, see alignment E=1.1e-15 PF04542: Sigma70_r2" amino acids 12 to 75 (64 residues), 44.9 bits, see alignment E=2e-15 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 14 to 157 (144 residues), 85.5 bits, see alignment E=1.6e-28 PF07638: Sigma70_ECF" amino acids 34 to 158 (125 residues), 30.4 bits, see alignment E=8.8e-11 PF08281: Sigma70_r4_2" amino acids 103 to 155 (53 residues), 50.2 bits, see alignment E=4e-17 PF04545: Sigma70_r4" amino acids 108 to 157 (50 residues), 34.1 bits, see alignment E=4e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 45% identity to rlg:Rleg_7159)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>GFF4551 hypothetical protein (Sphingobium sp. HT1-2)
MTGKRTDMEMEADLRAMRRYARALSRDHVVADDVVQDAVMRAIERRDQFQPDRSRRRWLL
AIVHNVFISAKRREAAETRRNLAFAQIQVDHADPDQEVRADLMQVARAFADLPDHQRAVM
HLTVVEGLSYQESADLLGIAVGTVMSRLARARATLRQDRDRQPRDRLRIVGGQDE