Protein Info for GFF455 in Xanthobacter sp. DMC5

Annotation: Riboflavin transport system permease protein RibX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 201 to 207 (7 residues), see Phobius details amino acids 210 to 236 (27 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 113 to 282 (170 residues), 93.4 bits, see alignment E=7.6e-31

Best Hits

Swiss-Prot: 33% identical to YTLD_BACSU: Uncharacterized ABC transporter permease protein YtlD (ytlD) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 96% identity to xau:Xaut_1531)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF455 Riboflavin transport system permease protein RibX (Xanthobacter sp. DMC5)
MTMQADAASAPFAAARAVPTEAEIEAKARARLKARRALVISLRIAILVAVLGIWEIGART
GFIDPFFFASPSGIAEQIWVWMTEGTSQGPLWVQIMVTLEETILGFFIGAVGGIVCGIVL
GRNKLLADVFSIYIKIANSIPRVVLGSIFIIALGLGMASKVALAVVMVFFVVFANAFQGV
READRAMIANAQILGASPFQITTSVIIPSAMSWILASLHVSFGFALVGAVVGEFLGAKQG
VGLLIATAQGAFNANGVFAAMIILAVVALVMEFLITLVENRLVKWRPVPYSEQN