Protein Info for GFF455 in Sphingobium sp. HT1-2

Annotation: putative dioxygenase ferredoxin subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13806: Rieske_2
  • amino acids 11 to 107 (97 residues), 58.8 bits, E=4.6e-20
• PF00355: Rieske
  • amino acids 12 to 96 (85 residues), 72.2 bits, E=2.8e-24

Best Hits

Swiss-Prot: 34% identical to NAGAB_RALSP: Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin component (nagAb) from Ralstonia sp.

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 45% identity to swi:Swit_2251)

MetaCyc: 32% identical to naphthalene 1,2-dioxygenase complex ferredoxin component (Pseudomonas sp. NCIB9816-4)
Naphthalene 1,2-dioxygenase. [EC: 1.14.12.12]

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

• naphthalene degradation (aerobic) (1/6 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Ethylbenzene degradation
• Fluorene degradation
• Naphthalene and anthracene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.12

Protein Sequence (109 amino acids)

>GFF455 putative dioxygenase ferredoxin subunit (Sphingobium sp. HT1-2)
MMNGAMTMLTFTAVAHVDDVPPGTAKAVDVDGESILLCHSNGRLFAVANRCSHADEPLAC
GRVRAGWIACPVHGARFDLETGRAMNPPAKAPIRVYELRIVDDRIEIAR