Protein Info for GFF4548 in Variovorax sp. SCN45

Annotation: Peptide-methionine (R)-S-oxide reductase MsrB (EC 1.8.4.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR00357: methionine-R-sulfoxide reductase" amino acids 45 to 167 (123 residues), 173.7 bits, see alignment E=9.2e-56 PF01641: SelR" amino acids 54 to 166 (113 residues), 167 bits, see alignment E=7.1e-54

Best Hits

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 65% identity to bra:BRADO5066)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>GFF4548 Peptide-methionine (R)-S-oxide reductase MsrB (EC 1.8.4.12) (Variovorax sp. SCN45)
MTHNTGRRFAIAAGTSTLGLAIAQAMGWFSRPAQAAENEKFEVTRTEAEWRKLLDANQFA
VLRQEGTERPYTSPLNDEHRAGTFSCAGCALDLFSSKTKFDSHTGWPSFWKPLDKAVGEH
TDRSFGMTRTEVHCSRCGGHLGHVFDDGPRPTGLRYCMNGVAMKFTAGSAQG