Protein Info for GFF4548 in Sphingobium sp. HT1-2

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details PF00892: EamA" amino acids 16 to 148 (133 residues), 47 bits, see alignment E=1.7e-16 amino acids 158 to 285 (128 residues), 48.4 bits, see alignment E=6.2e-17

Best Hits

KEGG orthology group: None (inferred from 80% identity to sch:Sphch_0062)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF4548 Permease of the drug/metabolite transporter (DMT) superfamily (Sphingobium sp. HT1-2)
VSSAATPSRPHRPLFAIGLRLVAVICLAVMFVTGRVADAHGVHLVETLFYRQALALPVVF
AWLAMSSGIGAIRTRRISVHATRMVIGLTGMALNFLSYILLPPAEATTIGFTMPIFGTIL
SALILREPTGIHRWAAVLIGFLGVLIMVRPEGGHFPPMGVAVAITAALVTASVSLVLREL
GRTESAGVVVFWFTALSVPPLGIGMLFYGQPHDAQTWGLLLMIGLFGGIAQLCLTAALRW
APVSVVLPMDYSSILWTTLLGWAIWGDWPMWTTWVGAALIIASGLYIAWREHRHARRIAT
A