Protein Info for GFF4546 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details PF00892: EamA" amino acids 4 to 136 (133 residues), 75.5 bits, see alignment E=2.6e-25 amino acids 151 to 282 (132 residues), 66.7 bits, see alignment E=1.3e-22

Best Hits

KEGG orthology group: None (inferred from 65% identity to del:DelCs14_5084)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF4546 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MWQYAFPLLAVVIWSGNTVVSKMAAGTIAPAEISFYRWLLAALLFTPLALRPVLRNWRAI
RPQLGRIAVLGLLGMVVYQSLAYYAAYLTTATHMGIIGSLTPMMVLALSIVLLGQRLTAG
AVAGSLVSIMGVLVVVSSGDLGTLLKSGANMGDGLMLLAMLAYAIYVILLKRWGMKGVPA
LQLLYLQIVFAVIALLPLYLLTPRMGLSAANLPLIGFAGLGASMLAPLVWMHTVAHIGPS
RASMFFNLIPLFTALIAAVVIGESLAAYHAIGGVLTVAGVLLAELWKAPLRRSRAVAA