Protein Info for GFF4542 in Sphingobium sp. HT1-2

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF02548: Pantoate_transf" amino acids 24 to 281 (258 residues), 344.5 bits, see alignment E=2e-107 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 37 to 286 (250 residues), 295.1 bits, see alignment E=2.6e-92

Best Hits

Swiss-Prot: 74% identical to PANB_NOVAD: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 86% identity to sjp:SJA_C1-24960)

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF4542 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Sphingobium sp. HT1-2)
MSTTFTLDTATSRANFTPAPMKRLTVPQIQRRKFEGKTDEPLVMLTAYTARQAQLLDPHC
DMLLVGDSLAQVIYGLPSTLPVTLDMMIAHGAAVVRGSYHSVVLVDMPFGSYEASPQQAF
ASASRVMAETDCAGVKLEGGEAMAETIRFLTQRGIPVMAHIGLTPQAVNALGGYGARGKS
QEEHAKILGDAKAVAAAGAFGMVVEGVMEELADIITTSVDIPVIGIGASARCDGQVLVAE
DMLGMFERTARFVKRYANLAETISQAAESYAAEVRNRSFPGDDQVYRPKK