Protein Info for PS417_23230 in Pseudomonas simiae WCS417

Annotation: preprotein translocase subunit SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 130 to 147 (18 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 255 to 283 (29 residues), see Phobius details PF07549: Sec_GG" amino acids 27 to 54 (28 residues), 45.5 bits, see alignment (E = 3.8e-16) TIGR00966: protein-export membrane protein SecF" amino acids 33 to 276 (244 residues), 268.8 bits, see alignment E=5.4e-84 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 89 to 273 (185 residues), 187.1 bits, see alignment E=3.7e-59 PF02355: SecD_SecF_C" amino acids 100 to 284 (185 residues), 221.8 bits, see alignment E=5.3e-70

Best Hits

Swiss-Prot: 75% identical to SECF_PSEAE: Protein translocase subunit SecF (secF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 99% identity to pfs:PFLU5074)

MetaCyc: 46% identical to Sec translocon accessory complex subunit SecF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3M3 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PS417_23230 preprotein translocase subunit SecF (Pseudomonas simiae WCS417)
MLRTINFMGVRNVAFGVTVLLTVLALFSWFHKGLNYGLDFTGGTLIELTYEKPADVTLVR
SELVKAGYHEAIVQSFGATTDLLVRMPGEDPQLGHQVAEALQKVGGDNPASVKRVEFVGP
QVGEELRDQGGLGMLMALVGIMIYLAFRFQWKFGVGAIVSLIHDVIVTVGILAYFQITFD
LTVLAAVLAIIGYSLNDTIVVFDRVRENFRVLRKATLIENINISTTQTLLRTMATSISTL
LAIAALMIFGGDNLWGFSLALFIGVLAGTYSSIYIANVVLIWLNLNSEDLIPPASTGKEV
DDRP