Protein Info for GFF4538 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, MarR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF12802: MarR_2" amino acids 37 to 85 (49 residues), 47 bits, see alignment E=3.6e-16 PF13463: HTH_27" amino acids 38 to 94 (57 residues), 32.6 bits, see alignment E=1.2e-11 PF01047: MarR" amino acids 42 to 85 (44 residues), 35.2 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 36% identical to SLYA_EDWI9: Transcriptional regulator SlyA (slyA) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K06075, MarR family transcriptional regulator, transcriptional regulator for hemolysin (inferred from 74% identity to vap:Vapar_0866)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>GFF4538 Transcriptional regulator, MarR family (Variovorax sp. SCN45)
MRLGTSLAVLQRGYRAAADKAVAHVGVSQTLAYPIVMLGRMNGEVRQGVLAEALGIEGPS
LVRSVDQLVEAGLVERREDPADRRAKTLHLTEAGQAVCAPIEAALTLMRVSLFDGVSDDD
VAACLRVFSVLEERMGVRAVQNPPPPPAPPQEGRK