Protein Info for GFF4537 in Xanthobacter sp. DMC5

Annotation: Anthranilate 1,2-dioxygenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13577: SnoaL_4
  • amino acids 19 to 156 (138 residues), 48.1 bits, E=1.1e-16
• PF00866: Ring_hydroxyl_B
  • amino acids 33 to 162 (130 residues), 56.2 bits, E=4.3e-19

Best Hits

Swiss-Prot: 39% identical to NAGH_RALSP: Salicylate 5-hydroxylase, small oxygenase component (nagH) from Ralstonia sp.

KEGG orthology group: K05709, small terminal subunit of phenylpropionate dioxygenase [EC: 1.14.12.19] (inferred from 46% identity to bpa:BPP0273)

MetaCyc: 43% identical to 6-hydroxypicolinate 3-monooxygenase subunit 4 (Alcaligenes faecalis)
1.14.13.-

Predicted SEED Role

"Ortho-halobenzoate 1,2-dioxygenase beta-ISP protein OhbA" in subsystem Benzoate degradation

MetaCyc Pathways

• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (2/5 steps found)
• cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (2/5 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (3/8 steps found)
• picolinate degradation (1/7 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.19

Protein Sequence (173 amino acids)

>GFF4537 Anthranilate 1,2-dioxygenase small subunit (Xanthobacter sp. DMC5)
MLNPASANAPSRDDLIDALLLKAEVEAFNEAYASALDEQRLADWAEMFTVNGFYNIISRE
NYDRKLPVGLIYCENRGMIRDRAFALEKTAMFAPRYLRHMVGNIKVAEAADGSIDATANY
VVFQVLFDRPDATIHQVGRYIDRFVREEGGLKLASRVCIYDSLLIDNALCIPV