Protein Info for GFF4534 in Sphingobium sp. HT1-2

Annotation: Bll3818 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 329 to 345 (17 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details PF01935: DUF87" amino acids 147 to 381 (235 residues), 158.7 bits, see alignment E=2.4e-50

Best Hits

KEGG orthology group: K06915, (no description) (inferred from 90% identity to sjp:SJA_C1-25040)

Predicted SEED Role

"Bll3818 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>GFF4534 Bll3818 protein (Sphingobium sp. HT1-2)
MPGAHQFSHDTGAAASSAGLHQALGMVFQIAGSSSKILVDPNSLAALAHDPDACLAMAGQ
VGSQVKMRVGERWLIANIRSLMLDRRDGGAIIADIDFLGEGDEEKLTGRIYGFRRGVTRY
PTPGTDIYPVSSYDMQQIYAADDRPHVQIGTVYPTMDTRAALYVDSMLGKHFALLGSTGT
GKSTSAALILHRICDLSPQGHIVMIDPHGEYGAAFQQNGAVFDVNNLALPYWLMNFEEHC
EVFVTSEGAERTQDCDILAKCLLAARMKNRLAESIGRLTVDSPVPYLLSDLTAILQNEMG
KLDKGTGSLPYLRLKSKVDEIKGDPRYSFMFSGMLVADSMQAFLAKVFRLPSGGKPISII
DVSSMPSDITSVVVSVLSRLVFDYALWARDEPQRPILLVCEEAHRYIPASTAGGGQAVRR
ILERIAKEGRKYGVSLGLITQRPSDLAEGVLSQCGTIISMRLNNDRDQAFVKAAMPEGAR
GFLDSIPALRNREAIICGEGVAVPIRVALDNLEEQRRPASGDPSFTQLWRQAGGEDDILT
RTITRWRNQGR