Protein Info for GFF4532 in Sphingobium sp. HT1-2

Annotation: Valyl-tRNA synthetase (EC 6.1.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 TIGR00422: valine--tRNA ligase" amino acids 5 to 930 (926 residues), 958.4 bits, see alignment E=1.7e-292 PF00133: tRNA-synt_1" amino acids 17 to 450 (434 residues), 303.2 bits, see alignment E=5.7e-94 amino acids 473 to 647 (175 residues), 162.5 bits, see alignment E=2.9e-51 PF09334: tRNA-synt_1g" amino acids 43 to 93 (51 residues), 31.4 bits, see alignment 1.8e-11 amino acids 593 to 651 (59 residues), 31.8 bits, see alignment 1.4e-11 PF08264: Anticodon_1" amino acids 689 to 827 (139 residues), 122.6 bits, see alignment E=2.6e-39 PF10458: Val_tRNA-synt_C" amino acids 885 to 950 (66 residues), 51.7 bits, see alignment 1.7e-17

Best Hits

Predicted SEED Role

"Valyl-tRNA synthetase (EC 6.1.1.9)" (EC 6.1.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (950 amino acids)

>GFF4532 Valyl-tRNA synthetase (EC 6.1.1.9) (Sphingobium sp. HT1-2)
MTELPKTFDPAAIETRWYQHWEANGLFRPDRPGAEPFTIVNPPPNVTGSLHVGHALDNTL
QDIVVRYERLRGKDALWVVGTDHAGIATQMVVERQLNAAGQKRTDFSRDDFVAKVWDWKA
ESGGAITSQLRRLGCSMDWANERFTMDEGFSRAVIKVFVELHQRGLLYRDKRLVNWDPHF
RSAISDLEVETKETQGGFWRFRYPLADGVTLADGSDHIVVATTRPETMLADMAIAVHPDD
TRYQAVIGKEILQPITGRRFKIVADEHADPELGSGAVKITPGHDFNDFEVGKRAGMKAAD
MLNMFDADANVVQTADGLIPDRFLGLHRFKKAGVDGAREIVVAEMKALGLLVPHVTKNKE
GEDVAADFEPRTIQTPYGDRSGVVIEPWLTDQWYVDAGKLAVAPMQAVRDGRIEIVPKSW
EKTFFNWMENIQPWCVSRQLWWGHQIPAWFGYPVWGAPFEKLQAEAIGNPSSPLPTFVAM
DEIEAVAQAEQFYRANWNLEGKNFSVVVGDEAGLNIDGSDVTATIRRDPDVLDTWFSSAL
WPFGTLGWPEQSETLSRHYPNDLLISGFDILFFWDARMAMQGMEFMGDVPWKKLYLHGLV
RAADGQKMSKSKGNVVDPLGLIDKFGADALRFFMAAMESQGRDVKMDEKRVEGYRNFATK
LWNAARFLQANGVTASTSREAPHATLPVNRWIIAETVATVQAIDTAMAELRFDAGANAIY
HFVWDQYCDWYIELTKGSMDDETKAVAGWAFDQILVMLHPFMPFITEELWQLTGARAQEL
IVAEWPVALYEVDTDAQGEIDWLIRLVSAIRTARTELNVPPGAKLRMVVRDASETTRGRL
DRQGAALARLGRIESLAFGEDVAGGAAQIVVDEATFILPLEGVIDIAAEKTRLEKALAAA
AKERDSLGGRLSNPAFVEKAKPEAVAKAREDHAEKTAEAERLKAALDRLG