Protein Info for GFF4531 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 12 to 59 (48 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 113 to 143 (31 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 384 to 402 (19 residues), see Phobius details amino acids 423 to 445 (23 residues), see Phobius details amino acids 465 to 493 (29 residues), see Phobius details amino acids 504 to 526 (23 residues), see Phobius details amino acids 557 to 578 (22 residues), see Phobius details PF06808: DctM" amino acids 14 to 332 (319 residues), 171 bits, see alignment E=2e-54 amino acids 351 to 581 (231 residues), 147.3 bits, see alignment E=3.1e-47

Best Hits

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>GFF4531 hypothetical protein (Xanthobacter sp. DMC5)
MIEFIAHNLAPIMFATLVVFMLLGYPVAFALAANGLLFFFIAVELSPYAPDAITLSWPLL
QALPERVFGTMANEVLLAIPFFTFMGLVLERSGMAEDLLETIGQLFGTVRGGLAYAVIFV
GALLAATTGVVAASVISMGLISLPIMLRYGYDRRLASGVIAASGTLAQIIPPSLVLIVMA
DQLGRSVGDMYEGAFLPGLVLSGLYALFVFVVTIVSPKSAPGLPREALTCCEPSGARGVW
QLGVLVAYSAAVATVVMRDTGIKAGADYAILAICVAVVVALVSALLNRFLGARRLVLSAV
LTAAFAGAYVMLRESGHPTAGLMADIVAAGALYAFIAGGVERFTGMPLVSRMAERVTFVM
VPPLLLIFLVLGTIFLGVATPTEGGAMGALGAMVLAALKRRLEKNPARFSLSILTQATQT
TAKLSAFAIFIVVGARVFSLTFYGINGHLWVEHLLTSLPGGQMGFLLFINALIFVLAFFL
DFFELAFIVVPLLAPAADKLGIDLIWLGVMLGVNMQTSFMHPPFGFALFYLRSVAPKTAY
LDRLTGKRMEPVTSAQIYWGAIPFVVIQLVMVGLIAAFPGMVMHYKSSAPTADPAAAQRQ
LDSLDAPASGLGLPSMPGLDDLPKPGAGL