Protein Info for GFF4529 in Sphingobium sp. HT1-2

Annotation: Alanyl dipeptidyl peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF07676: PD40" amino acids 44 to 73 (30 residues), 17.2 bits, see alignment (E = 1.2e-06) amino acids 94 to 121 (28 residues), 26.5 bits, see alignment (E = 1.5e-09) amino acids 231 to 249 (19 residues), 12.9 bits, see alignment (E = 2.7e-05) amino acids 280 to 298 (19 residues), 18.5 bits, see alignment (E = 4.7e-07) PF05448: AXE1" amino acids 421 to 504 (84 residues), 21.4 bits, see alignment E=3e-08 PF20434: BD-FAE" amino acids 444 to 635 (192 residues), 31.4 bits, see alignment E=4.2e-11 PF00326: Peptidase_S9" amino acids 472 to 681 (210 residues), 201.9 bits, see alignment E=2.9e-63

Best Hits

KEGG orthology group: None (inferred from 84% identity to sch:Sphch_1573)

Predicted SEED Role

"Alanyl dipeptidyl peptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (686 amino acids)

>GFF4529 Alanyl dipeptidyl peptidase (Sphingobium sp. HT1-2)
MKHILLAGLGALALSPMLSSVLVAPAAARPFTPNDMVSLDRVSSPTVSPDGKWMAYQLRS
TDLANNRGRTDLYLLAIDKAGQAPRLIASVPDKNEASPVFSADGSALYYVSNASGDDQLW
RAPIAGGQPVQISKAPGGISGFLLNPQGDKVALWADRPVGARTIDDVKAPTPPSAGSGRV
YDQLFVRHWDTWSDGQRSQIFVMPVAGGKAVSVMGGLVGDSPSKPFGGAEELAWSADGKT
LFFALREAGRIEPLSTNLDIFSVPADGSAKPVNLTDANDATDTMPVVSPDGKWLAYAAMK
RPGYEADRLVLMLRNIATGETRALTEGWDRSVGSIAWEAHGKGLLVTANDVLDNPVFRVD
AASGKVTRLTEKGHAGSVVPLPDGGFVYALDSIQSPADFWKMPAKGKPVRLTNVNAQKLA
GVDDVSVQRFSFKGANGDTVWGQIVKPMAAKGKLPVAFLVHGGPQGSFNDSWSYRWNPKA
FAAHGYAAVIVDFHGSTGYGQAFTDAINQDWGGKPLEDLKLGLAAAAAKDANVDAKNACA
LGASYGGYMMNWIEGQWADGFKCIVQHDGVFDARAMAYETEELWFDEWEHGGPYYEKPEE
FEKWNPVNHVAQWKTPMLVVTGEKDFRIPYTQGLAAFTALQRREIPSRLVVFPDENHWVL
KPKNSLQWYDEALGWLDQWTGAAKGK