Protein Info for PS417_23155 in Pseudomonas simiae WCS417

Annotation: pilus assembly protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 8 to 240 (233 residues), 244.9 bits, see alignment E=4e-77 PF13181: TPR_8" amino acids 39 to 69 (31 residues), 14.5 bits, see alignment 1.5e-05 amino acids 142 to 171 (30 residues), 13.5 bits, see alignment 3.2e-05 PF13432: TPR_16" amino acids 76 to 131 (56 residues), 26.8 bits, see alignment E=2.6e-09 amino acids 152 to 200 (49 residues), 15.9 bits, see alignment 6.8e-06

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 96% identity to pfs:PFLU5059)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U173 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PS417_23155 pilus assembly protein PilW (Pseudomonas simiae WCS417)
MPLRLALLLLVTGLAAGCVSSGHESPLQTGKGREEARVAYVQLGLGYLQQGMSEHAKVPL
KKALELDSDDPDANGALALVFQAQAEPELAEQYFHKALAARPADPRLLNNYGSFLFEQTR
YDQAALYFQQASTDTLYPERSRVFENLGVTSMRLGQRDSARQHLEKALHLNGRQPRALLE
MAELSYEDRHYVPARDYYERFSLLSGQNARSLLLGVRLATVHEERDTAARFGQQLERLYP
GTPEYQQYLSEQ