Protein Info for GFF4523 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG000859: hypothetical protein YebC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 2 to 238 (237 residues), 300.3 bits, see alignment E=5.7e-94 PF20772: TACO1_YebC_N" amino acids 5 to 76 (72 residues), 111.1 bits, see alignment E=3e-36 PF01709: Transcrip_reg" amino acids 82 to 237 (156 residues), 198.2 bits, see alignment E=7.2e-63

Best Hits

Swiss-Prot: 84% identical to Y1898_ACISJ: Probable transcriptional regulatory protein Ajs_1898 (Ajs_1898) from Acidovorax sp. (strain JS42)

KEGG orthology group: None (inferred from 86% identity to adk:Alide2_2338)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>GFF4523 FIG000859: hypothetical protein YebC (Hydrogenophaga sp. GW460-11-11-14-LB1)
VAGHSKWANIQHRKGRQDEKRGKIWTRVIREITVAARQGGGDPAMNPRLRLAIDKAKAAN
MPADRIKYNVDKASGNLEGQALEEIRYEGYGIGGAAVIVDTMTDNRVRTVAEVRHAFSKY
GGNLGTDGSVSFQFKHCGQLVFAPGTSEDKVMEIALEAGADDVISDGDGAIEVLTSPVTF
EAVRNALEAAGLKPEVAEVTMRAENTIELTGDDAARMQKLLDVLEDLDDVQDVFHNAEIG
E