Protein Info for PS417_02310 in Pseudomonas simiae WCS417

Annotation: heptose 1-phosphate adenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 TIGR02198: bifunctional protein RfaE, domain I" amino acids 5 to 312 (308 residues), 411 bits, see alignment E=4.7e-127 PF00294: PfkB" amino acids 13 to 303 (291 residues), 152.8 bits, see alignment E=2.1e-48 PF08543: Phos_pyr_kin" amino acids 186 to 286 (101 residues), 33.7 bits, see alignment E=3.8e-12 TIGR02199: bifunctional protein RfaE, domain II" amino acids 331 to 471 (141 residues), 211.5 bits, see alignment E=6.3e-67 TIGR00125: cytidyltransferase-like domain" amino acids 341 to 407 (67 residues), 58.8 bits, see alignment E=7e-20 PF01467: CTP_transf_like" amino acids 343 to 438 (96 residues), 67.5 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 99% identical to HLDE_PSEFS: Bifunctional protein HldE (hldE) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03272, D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC: 2.7.1.- 2.7.7.-] (inferred from 99% identity to pfs:PFLU0482)

MetaCyc: 58% identical to fused heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-4342 [EC: 2.7.7.70]; RXN0-4341 [EC: 2.7.7.70, 2.7.1.167]

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-, 2.7.1.-, 2.7.7.-

Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.1.167 or 2.7.7.- or 2.7.7.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVM8 at UniProt or InterPro

Protein Sequence (474 amino acids)

>PS417_02310 heptose 1-phosphate adenyltransferase (Pseudomonas simiae WCS417)
MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVEQIEDRPGGAANVALNI
AALGAPASLVGVTGDDEAADSLANSLRGAGVRALFQRIAHQPTIVKLRVMSRHQQLLRID
FEEPFTTDALALRGQVDQLLEGIKVLVLSDYGKGALKNHQELIQAAKAKGIPVLADPKGK
DFSIYRGASLITPNLSEFEAIVGGCTDEHDLVTKGAALMADLDLGALLVTRGEHGMTLLR
PGHPAMHLPARAREVFDVTGAGDTVISTLAASIAAGEELPHAVALANLAAGIVVGKLGTA
AISAPELRRAIQRSEGSERGVLTIEQLLLAIDDARAHNESIVFTNGCFDILHAGHVTYLE
QARAQGDRLIVAVNDDASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISFPEATPENLL
AQVKPDVLVKGGDYSVDQVVGADIVSAYGGKVKVLGLVENSSTTAIVEKIRNNE