Protein Info for GFF4519 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF01590: GAF" amino acids 22 to 157 (136 residues), 27.1 bits, see alignment E=1.4e-09 PF00158: Sigma54_activat" amino acids 189 to 355 (167 residues), 227.7 bits, see alignment E=1.7e-71 PF14532: Sigma54_activ_2" amino acids 190 to 360 (171 residues), 78.5 bits, see alignment E=1.5e-25 PF01078: Mg_chelatase" amino acids 202 to 332 (131 residues), 21.9 bits, see alignment E=2.6e-08 PF07728: AAA_5" amino acids 212 to 333 (122 residues), 39.5 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 79% identical to NORR1_CUPNH: Nitric oxide reductase transcription regulator NorR1 (norR1) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 75% identity to har:HEAR1362)

Predicted SEED Role

"Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>GFF4519 Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTTSFHLLLLTDLVVDLPVAVRLQRLVGSLRAHFGCGAVALLKLEGEHLRPVAVDGLTSD
ALGRRFLVKDHPRLATILQRRGVTRFHHDSSLPDPYDGLIDERAGEPLPVHDCMGMALDV
EGERWGVITLDALQVGAFNAQAQRDLAELASAIEAAVRVTRLEAEIRGLRLSTGGSPAGS
QAPREESELVGQSDAIAHLLHELQVVADSELPVLLLGETGVGKELFAHRLHQLSRRAAKP
LVHVNCAALPESLAESELFGHARGAFSGAVSDRPGRFEAAEGGTLFLDEVGELPLSIQAK
LLRTLQNGEIQRLGADQPRRVNVRVIAATNRSLRDHVRDGSFRADLYHRLSVYPIPIPPL
RERGNDVLLLAGRFLELNRARLGLRSLRLSVQAEDALRRYRWPGNVRELEHVISRAALKA
VSRGADRKDIVTLEADMLDLDALVVPPGETLPVAVLPARAAPMNDLIEDCQRQAIRQALA
AHQDNWAAAARQLALDPSNLHKLARRLGLKK