Protein Info for GFF4517 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter YtbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 331 to 356 (26 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 319 (312 residues), 153.5 bits, see alignment E=1.1e-48 PF06779: MFS_4" amino acids 12 to 375 (364 residues), 51.8 bits, see alignment E=1.3e-17 PF00083: Sugar_tr" amino acids 40 to 179 (140 residues), 31.3 bits, see alignment E=1.6e-11

Best Hits

Swiss-Prot: 55% identical to YTBD_BACSU: Uncharacterized MFS-type transporter YtbD (ytbD) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to vpe:Varpa_0942)

Predicted SEED Role

"Putative drug efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>GFF4517 Uncharacterized MFS-type transporter YtbD (Variovorax sp. SCN45)
MPIALLALTLSAFAIGTTEFVIVGLIPTVAADLHIGLPSAGLLVSLYALGVAIGAPVLTA
LTGKLPRKALLLSLMALFTVGNLLAWQAPSYESLIAARVLTGLAHGVFFSIGSTIATGLV
PKEKAASAIAIMFTGLTVALVTGVPLGTFIGQHFGWRETFLAVSALGVVAFIGSWVFVPS
NIRHTPPASLAQQAKVLAEPRLLLVYAKTAIGYGGSFIPFTFLAPILTEVSGFSAGAVGW
VMLVYGVSVAVGNIWGGKLADRRGPIPALKIIFALLAAVLLLFNFAAPHKWLALLAVLMW
GAVAFGNVPGLQVYVVKQAERFTPQAVDVASGLNIAAFNLGIAGAAWAGGLIVTHLGLMH
TPWIGALVVLVSLALTQWSGSLDRRAGIPVRASGPVPVGH