Protein Info for GFF4511 in Xanthobacter sp. DMC5

Annotation: Flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details amino acids 305 to 322 (18 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 15 to 692 (678 residues), 861.7 bits, see alignment E=1.9e-263 PF00771: FHIPEP" amino acids 26 to 684 (659 residues), 778.2 bits, see alignment E=3.9e-238

Best Hits

Swiss-Prot: 69% identical to FLHA_BRUME: Flagellar biosynthesis protein FlhA (flhA) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 82% identity to azc:AZC_0654)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (693 amino acids)

>GFF4511 Flagellar biosynthesis protein FlhA (Xanthobacter sp. DMC5)
MSDITVRDAAQGSRRDIGFAMGMVGILAILFLPIPPALIDIGLALSIALSVLILMVALWI
DKPLEFSAFPTVLLIATLLRLGLGVATTRLILAHGSDGVSAAGHIIHGFSQLVMSGDFVI
GIVVFLILVTVNFLVITKGATRIAEVGARFTLDAIPGKQMAIDADLNAGLIDDKQAQRRR
AELEEESAFFGSMDGASKFVRGEAVASLITIAVNIFGGIIIGVTRHKMPIADAADIFTRL
SVGDGLVSQIPALIVSLSAGLLVSKGGTRGRAEKAVLGQLGAYPRALFVAAGLLLALALV
PGLPFLPFAIIGGMMAFVGWSVPRQLARQKAEADAREADAKQQADREARESVKEQLKTAE
IEVCVGKQLATQVLRTPSELGNRLGKMRRKFALRYGFVVPEIRMTESLAAPAKGYQIKMH
GTVLAAQEMRIGELLVVVGDGPPPDVPGDEAREPAFGMKAMWIPEAYATEVKREGFAPVD
NLTVILTHLSEAIANNLPQLLSYKSMRSLIDRLDPEYKRLVEDICPAQISYSGLQAVLKL
LLAERVSIRNLHLILEAVAEIVPHARRSEQVAEHVRMRMAQQICGDLAEGGVLNVLRLGS
RWDLAFHQSLKRDAKGEVIEFDIDPRLVEQFGTEAATAVRERMKAGAPFVLVTAPDARPY
VRMIVERMFPSLPVLSHVEIARGVEIKALGAIS