Protein Info for GFF4505 in Sphingobium sp. HT1-2

Annotation: NAD(P)H oxidoreductase YRKL @ Putative NADPH- quinone reductase (modulator of drug activity B) @ Flavodoxin 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 transmembrane" amino acids 79 to 93 (15 residues), see Phobius details PF02525: Flavodoxin_2" amino acids 10 to 103 (94 residues), 68.2 bits, see alignment E=8.3e-23 PF03358: FMN_red" amino acids 13 to 102 (90 residues), 29.7 bits, see alignment E=4.6e-11

Best Hits

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (103 amino acids)

>GFF4505 NAD(P)H oxidoreductase YRKL @ Putative NADPH- quinone reductase (modulator of drug activity B) @ Flavodoxin 2 (Sphingobium sp. HT1-2)
MADSPAARGRHTIILAHPDPGSFNAAVADAYADAVREYGQEATIRDLYAMGFDPLLKNEE
RPDRRGSSLSRDVRAELDALTGSDVIALVYPIWFGMPPAMLKG