Protein Info for GFF4503 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (EC 1.3.1.28) of siderophore biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00106: adh_short" amino acids 9 to 188 (180 residues), 157.3 bits, see alignment E=6.8e-50 TIGR04316: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase" amino acids 11 to 250 (240 residues), 353.6 bits, see alignment E=3.3e-110 PF08659: KR" amino acids 12 to 158 (147 residues), 34.4 bits, see alignment E=4.2e-12 PF01370: Epimerase" amino acids 12 to 186 (175 residues), 23.4 bits, see alignment E=7.3e-09 PF13561: adh_short_C2" amino acids 15 to 248 (234 residues), 169.6 bits, see alignment E=1.8e-53

Best Hits

Swiss-Prot: 91% identical to ENTA_ECOLI: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (entA) from Escherichia coli (strain K12)

KEGG orthology group: K00216, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase [EC: 1.3.1.28] (inferred from 100% identity to spq:SPAB_02965)

MetaCyc: 91% identical to 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (Escherichia coli K-12 substr. MG1655)
2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase. [EC: 1.3.1.28]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>GFF4503 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (EC 1.3.1.28) of siderophore biosynthesis (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTGFDFSDKTVWVTGAGKGIGYATALAFVDAGARVIGFDREFTQENYPFATEVMDVADAA
QVAQVCQRVLQKTTRLDVLVNAAGILRMGATDALSVDDWQQTFAVNVGGAFNLFSQTMAQ
FRRQQGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALTVGLELAGCGVRCNVVSPGST
DTDMQRTLWVSEDAEQQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQD
IVVDGGSTLGA