Protein Info for GFF45 in Xanthobacter sp. DMC5

Annotation: Spermidine/putrescine import ATP-binding protein PotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF00005: ABC_tran" amino acids 49 to 191 (143 residues), 129.8 bits, see alignment E=1.1e-41 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 64 to 389 (326 residues), 406.6 bits, see alignment E=3.6e-126 PF08402: TOBE_2" amino acids 309 to 390 (82 residues), 73 bits, see alignment E=1.7e-24

Best Hits

KEGG orthology group: K11076, putrescine transport system ATP-binding protein (inferred from 86% identity to xau:Xaut_2941)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>GFF45 Spermidine/putrescine import ATP-binding protein PotA (Xanthobacter sp. DMC5)
MGEVMAADKARKETIGAVRRTFAPWKDPTQTPLIRFENVVKRFGDFTAVNNVSLDIYERE
FFALLGPSGCGKTTLMRMLAGFEEPSSGRLTLAGEDLAGVPPYRRPVNMMFQSYALFPHM
NVADNIAFGLKQDKMPKADIDARVEEMLTLVKLEKFAKRKPHQLSGGQRQRVALARSLAK
RPKVLLLDEPLGALDKKLREETQFELMDLQMDLGMTFLIVTHDQEEAMTVADRIAVMNHG
VLVQVDPPAEIYEQPATRYIADFIGEVNLIESTVTACEGDVTRLTSDVTTSPLTVAHPCE
VAAGGNACIAIRPEKLRISLDPPPEGSENVFAGEIWDIGYLGDLNIYHVELACGQRLKVS
QPNLSRRVARPISWDDKVWVTFDPDAGVLLTR