Protein Info for GFF4497 in Variovorax sp. SCN45

Annotation: FIG027115: Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details PF07291: MauE" amino acids 8 to 93 (86 residues), 35.2 bits, see alignment E=1.4e-12 PF07681: DoxX" amino acids 15 to 89 (75 residues), 53.6 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_0957)

Predicted SEED Role

"FIG027115: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>GFF4497 FIG027115: Membrane protein (Variovorax sp. SCN45)
MRWTTTPALRWIALLLLCAAYLQGGLNKAMDFDAALAEMNHFGMSPAGPLAVAVIVLELG
ASALILTGRLRWLGALALAGFTLMATFVALRFWQMPVGQERFMAANSFFEHLGLVGGFLL
VAWHDLKERAHV