Protein Info for GFF4496 in Xanthobacter sp. DMC5

Annotation: Flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF14842: FliG_N" amino acids 12 to 113 (102 residues), 78.4 bits, see alignment E=1.2e-25 PF14841: FliG_M" amino acids 122 to 194 (73 residues), 70.2 bits, see alignment E=2.9e-23 PF01706: FliG_C" amino acids 223 to 329 (107 residues), 90 bits, see alignment E=2.4e-29

Best Hits

Swiss-Prot: 34% identical to FLIG_BRADU: Flagellar motor switch protein FliG (fliG) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 77% identity to azc:AZC_0640)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>GFF4496 Flagellar motor switch protein FliG (Xanthobacter sp. DMC5)
MPAASAAKPRPLQGIDRVAALLMAMGTPAANRVMKHFEPDEIRLITRSIASLKPVSTAQI
ESLVEDFASNFAGGANLVGTVADVERLLQGVLPPEQIADIMNDIMGAANQSIWDRISTVN
ENVLATYVAKEHPQTAALMLSKVRPACAAKVLSFIPEEKRNGIMRRMLTFKPIVDATMQV
IERTVHEDFMMNFSRNAGADPHARMADIINKMDRDAMETVLASLASTRPKSAEILKGLLF
TFDDIVKLTPRARTALFDQVPTDKLVLALKGTDPEFREIILQSLGARVRRMVEQEMAGSE
PAPAKDVMEARRTVTDLALDMAGRGEIEISSGTEEDAYVR