Protein Info for GFF4492 in Sphingobium sp. HT1-2

Annotation: Flagellar biosynthesis protein FliQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details PF01313: Bac_export_3" amino acids 11 to 78 (68 residues), 82.1 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 44% identical to FLIQ_ECOL6: Flagellar biosynthetic protein FliQ (fliQ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02420, flagellar biosynthetic protein FliQ (inferred from 51% identity to swi:Swit_0216)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (90 amino acids)

>GFF4492 Flagellar biosynthesis protein FliQ (Sphingobium sp. HT1-2)
METYSPFSVSMGQALWVIMVVAGPPLIIMLVVGLIISMIQAATSINEQTVSFVPKLLAFI
LFLALYGATVGDLLIGYTRDLLTHIPDDIR