Protein Info for GFF4491 in Xanthobacter sp. DMC5
Annotation: Flagellar hook-basal body complex protein FliE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 45% identical to FLIE2_BRADU: Flagellar hook-basal body complex protein FliE 2 (fliE2) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 53% identity to pgv:SL003B_3890)Predicted SEED Role
"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (108 amino acids)
>GFF4491 Flagellar hook-basal body complex protein FliE (Xanthobacter sp. DMC5) MIDAVSLNALSRATATSATTAARATEAASATQSAGSISDFSTMLARMSSDAVDQVKTAEA SAISGIHGKVSVQQVVEAVMSAEQTLQTAIAVRDKVVAAYQEISRMAI