Protein Info for GFF449 in Variovorax sp. SCN45

Annotation: Cobyrinic acid a,c-diamide synthetase (EC 6.3.5.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR00379: cobyrinic acid a,c-diamide synthase" amino acids 25 to 456 (432 residues), 265.2 bits, see alignment E=5.5e-83 PF01656: CbiA" amino acids 26 to 203 (178 residues), 63.4 bits, see alignment E=3.1e-21 PF07685: GATase_3" amino acids 260 to 451 (192 residues), 107.5 bits, see alignment E=1.1e-34

Best Hits

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 83% identity to vpe:Varpa_3378)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF449 Cobyrinic acid a,c-diamide synthetase (EC 6.3.5.11) (Variovorax sp. SCN45)
VDAAISNPSQRSDTAGAAAAACAAVLVAAPASGQGKTTVAAALARLHARQGRRVRAFKCG
PDFLDPLWLALATGAPVHSLDLWMTGEADCRERLRAAAADCDLLIVEGVMGLFDGTPSAA
DLSQRFGLPVLAVIDAHAMAGTFGALAYGLQNFRPGLPWAGVLANRVGSERHAGMLKEAL
REPSRWLGALPRDAGFTLPERHLGLVVADELGDAMARLDAVADVLAGTLLGQLDVAQLPQ
VRFDAAPPVAPVAPLLAGSTIAIARDAAFSFIYPANLDVLGALGARLSFFSPLAGDALPA
CDAVWLPGGYPELHAEALSRCEPMRAELAAHVAAGKPVWAECGGMMALFDELATHDDGAG
DRNVHRLWGLLPGRVTMQKRLAGLGPQQLQLGGHALRGHTFHYSRCETPLAPVARTARPG
TTQAVGAQGGEALYVHGPVRASYFHAWFASSPEATACLFGAMPIELQSHAPHE